|
1.
Image Processing, Mathematica, CWeb, paralell Algorithms and other ... Parallel Image processing with Mathematica and algorithms in CWeb. Pages for the documentation of my research at University Leipzig. ... 2.
Alexander Ullrich*, Christoph Flamm * aullrich@tbi.univie.ac.at ... File Format: PDF/Adobe Acrobat - View as HTML aullrich@tbi.univie.ac.at. Introduction ... In the future we will also be able to calculate solvation energies, allowing us to ... 3.
CiXlox gi|22854870|gb|AAN09794.1|AF466105_1 Xlox [Ciona ... ... caudal type homeo box transcription factor 1 [Homo sapiens] MYVGYVLDKDSPVYPGPARPASLGLGPANYGPPAPPPAPPQYPDFSSYSHVEPAPAPPTAWGAPFPAPKD ... 4.
Partition Function and Base Pairing Probabilities of RNA Heterodimers File Format: Adobe PostScript - View as HTML extension of McCaskill’s partition function algorithm to compute base pairing probabilities, ..... partition functions for subsequences of the isolated A ... 5.
SnoReport 1.2 ============= by Jana Hertel: jana@tbi.univie.ac.at ... SnoReport 1.2 ============= by Jana Hertel: jana@tbi.univie.ac.at or ... in a bash the command would be: $ export MANPATH=$MANPATH:/home/mescalin/jana/man/ ... 6.
Professur für Bioinformatik - Universität Leipzig Professur für Bioinformatik. Uni Leipzig · Home · Address/Location · People · Publications · Software · Collaborations · Research Projects · Teaching ... 7.
Preprint: Relative Rate Tests for Footprints Mar 8, 2004 ... Phylogenetic Footprints, Non-coding sequence conservation, HoxA cluster, relative rate test. Alternative Numbers: ... 8.
Professur für Bioinformatik - Universität Leipzig - Conferences DAAD Summer School, Shanghai, China, 2007-09-30, 2007-10-13. 22th TBI Winterseminar, Bled (Slovenia), 2007-02-18, 2007-02-24 ... 9.
CamilleStephan-OttoAttolini File Format: PDF/Adobe Acrobat - View as HTML Winter Seminar of the TBI, Bled, Slovenia. 2003. Research visit to Prof. ... 2007-… Revision of Mathematics official textbooks for use in secondary schools, ... 10.
Publications Matthias Kruspe, Peter F. Stadler BMC Bioinformatics 8: 254 (2007) ..... highly structured leader of retrotransposon Tto1 mRNA increases transposition rate ... |
