Overview
Ads (0)
PPC Keywords (0)
Organic Keywords (446)
Competitors (844)
Sub-Domains
mrc-lmb.cam.ac.uk
Paid Keywords
Keywords found: 0
#Competitors: 0
#Ad Copies: N/A
 
Organic Keywords
Keywords found: 446
#Competitors: 862
Average Position: N/A
 
PPC Overview
No Results Found
Organic Overview
Keywords (446) Position
entrez 3
site file 17
entrez pub 1
entrez pub med 1
pub entrez 1
pub med entrez 1
bioinformatics is 6
ramakrishnan 2
the fluctuation 4
rama krishnan 2
View More »
Competitors (862) Keywords
en.wikipedia.org 28,718,623
ncbi.nlm.nih.gov 1,931,895
linkinghub.elsevier.com 4,514,823
rcsb.org 4,153
ebi.ac.uk 27,500
scop.mrc-lmb.cam.ac.uk 4,057
pnas.org 357,502
wiki.answers.com 4,150,848
nature.com 972,788
cellbio.utmb.edu 4,419
View More »
Organic Listing Variations
1.
Theoretical and Computational Biology Group
Please update your bookmark to our new TCB page.
2.
TF
CG5102-RA (710) (HLH). MATSDDEPMHLYEVFQNCFNKIANKQPTGTVGADRGGGGGYHSPYGSLGVENGMYPSDFNSMHDT VNGGNNRYANASTVDQYFDSAAAGSGGAWCQPQMSSANSYMGQSAYQNSGPLSGHSIDQQQQQVH ...
3.
England North
Maryport & Workington (West Cumberland) Times & Star · Matlock Mercury · (Middlesborough) NE Evening Gazette · Middleton Guardian · Middlewich Guardian ...
4.
UNIX tutorial
Program waits for input; Quit with ^C (i.e. Ctrl C, one of the most useful UNIX commands!) bobscript < pretty_pic.inp > pretty_pic.ps ...
5.
Coot Tutorial
File Format: PDF/Adobe Acrobat - View as HTML Mar 23, 2005 ... When you first start coot for this tutorial, you may see a ..... Refmac is the program that does Maximum Likelihood refinement of the model ...
6.
UNIX tutorial
... alias xfit /local/src/xtalview/XtalView/bin/decalphaOSF1V4/xfit ... alias clustalw /gn0/sat/Bin/clustalw; alias reformat /gn0/sat/Bin/reformat ...
7.
pre-SCOP - Superfamily: Ran binding protein zinc finger-like (90209)
Ran binding protein zinc finger-like (90209). contains CxxxxC-x(n)-CxxC zinc-binding site; similar to the Sec23/24 zinc finger domain ...
8.
pre-SCOP - Family: Hepatitis C virus N-terminal capsid protein ...
Fold, Hepatitis C virus N-terminal capsid protein fragment 2-45 (58667). 3. Superfamily, Hepatitis C virus N-terminal capsid protein fragment 2-45 (58668) ...
9.
pre-SCOP - Superfamily: Orange domain-like (998084)
Fold, Orange domain-like (998085). 4 helices; dimer of identical alpha-hairpin subunits; ... Family Children. Hairy Orange domain (998083). Pfam 07527.
10.
pre-SCOP - Family: Hairy Orange domain (998083)
Fold, Orange domain-like (998085) ... Superfamily, Orange domain-like (998084) ... Family. Hairy Orange domain (998083). Pfam 07527 ...
 
View More »
ascSort Ascending
descSort Descending
eqEquals...
!eqDoes Not Equal...
gtGreater Than...
gteqGreater Than or Equal To...
ltLess Than...
lteqLess Than or Equal To...
      And   Or
                
Sometimes you don’t know exactly what you are looking for in a Research data. That’s when our searching options may come handy.
The Domain Search
This search allows you to enter the domain name of the site you want to analyze. For example, you may enter “amazon.com” in the KeywordSpy search bar.

The Keyword Search
This will let you enter terms and key phrases in the search bar such as “send flowers”, “cover letters”, “keyword software,” and even a single broad term like “chocolate”.

The Ad Copy Search
This allows you to enter any texts or content included in an ad copy, whether the ones in ad copy headline or the ones in description lines. For example: “sunglasses”.
The Destination URL Search
This search allows you to enter the destination URL of the site that you want to analyze.

The destination URL is the address where a searcher is taken when an advertisement copy in search engines is clicked. Please take note that the destination URL differs from the display URL which appears at the bottom of advertisement copies.

Please be reminded to always include http:// at the beginning of your Destination URL search. For example: “http://www.proflowers.com”.

In addition, if you want to find all the ads that KeywordSpy indexed for a specific affiliate network e.g. Hydra Network. You should search in Destination URL the string lynxtrack.com.
Loading
  Loading...